Lineage for d1p93a_ (1p93 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008769Protein Glucocorticoid receptor [89140] (1 species)
  7. 2008770Species Human (Homo sapiens) [TaxId:9606] [89141] (6 PDB entries)
  8. 2008779Domain d1p93a_: 1p93 A: [87986]
    complexed with coactivator peptide, chains E, F, G and H
    complexed with dex

Details for d1p93a_

PDB Entry: 1p93 (more details), 2.7 Å

PDB Description: crystal structure of the agonist form of glucocorticoid receptor
PDB Compounds: (A:) Glucocorticoid receptor

SCOPe Domain Sequences for d1p93a_:

Sequence, based on SEQRES records: (download)

>d1p93a_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]}
qltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfrn
lhlddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpdmydqckhm
lyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaivkreg
nssqnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysn
gnikkllfhq

Sequence, based on observed residues (ATOM records): (download)

>d1p93a_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]}
qltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfrn
lhlddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpdmydqckhm
lyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaivkrss
qnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysngni
kkllfhq

SCOPe Domain Coordinates for d1p93a_:

Click to download the PDB-style file with coordinates for d1p93a_.
(The format of our PDB-style files is described here.)

Timeline for d1p93a_: