Lineage for d1p8va1 (1p8v A:1-278)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2098542Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2098611Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2098754Family c.10.2.7: Ngr ectodomain-like [75142] (7 protein domains)
  6. 2098776Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (1 species)
  7. 2098777Species Human (Homo sapiens) [TaxId:9606] [75144] (10 PDB entries)
  8. 2098784Domain d1p8va1: 1p8v A:1-278 [87985]
    Other proteins in same PDB: d1p8v.1, d1p8va2
    complexed with dfp, mes, nag

Details for d1p8va1

PDB Entry: 1p8v (more details), 2.6 Å

PDB Description: crystal structure of the complex of platelet receptor gpib-alpha and alpha-thrombin at 2.6a
PDB Compounds: (A:) platelet glycoprotein ib alpha chain

SCOPe Domain Sequences for d1p8va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8va1 c.10.2.7 (A:1-278) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}
hpicevskvashlevncdkrdltalppdlpkdttilhlsenllytfslatlmpytrltql
nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
rglgelqelylkgnelktlppglltptpkleklslannnltelpagllnglenldtlllq
enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt
snvasvqcdnsdkfpvykypgkgcptlgdegdtdlydy

SCOPe Domain Coordinates for d1p8va1:

Click to download the PDB-style file with coordinates for d1p8va1.
(The format of our PDB-style files is described here.)

Timeline for d1p8va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p8va2