Lineage for d1p8qb_ (1p8q B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129859Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2129860Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2129861Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 2129882Protein Arginase [52770] (5 species)
  7. 2129989Species Norway rat (Rattus norvegicus) [TaxId:10116] [52771] (34 PDB entries)
    Uniprot P07824
  8. 2130060Domain d1p8qb_: 1p8q B: [87975]
    complexed with gol, mn

Details for d1p8qb_

PDB Entry: 1p8q (more details), 2.95 Å

PDB Description: structural and functional importance of first-shell metal ligands in the binuclear cluster of arginase i.
PDB Compounds: (B:) arginase 1

SCOPe Domain Sequences for d1p8qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8qb_ c.42.1.1 (B:) Arginase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
htdintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvegldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhkpetdyl

SCOPe Domain Coordinates for d1p8qb_:

Click to download the PDB-style file with coordinates for d1p8qb_.
(The format of our PDB-style files is described here.)

Timeline for d1p8qb_: