Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) |
Family c.42.1.1: Arginase-like amidino hydrolases [52769] (2 proteins) |
Protein Arginase [52770] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [52771] (18 PDB entries) |
Domain d1p8pa_: 1p8p A: [87971] |
PDB Entry: 1p8p (more details), 2.5 Å
SCOP Domain Sequences for d1p8pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p8pa_ c.42.1.1 (A:) Arginase {Rat (Rattus norvegicus)} kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq ivknprsvgkaneqlaavvaetqkngtisvvlggdnsmaigsisgharvhpdlcviwvda htdintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg tkregnhkpetdyl
Timeline for d1p8pa_: