Lineage for d1p8pa_ (1p8p A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 314927Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 314928Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) (S)
  5. 314929Family c.42.1.1: Arginase-like amidino hydrolases [52769] (2 proteins)
  6. 314930Protein Arginase [52770] (2 species)
  7. 314962Species Rat (Rattus norvegicus) [TaxId:10116] [52771] (18 PDB entries)
  8. 314981Domain d1p8pa_: 1p8p A: [87971]

Details for d1p8pa_

PDB Entry: 1p8p (more details), 2.5 Å

PDB Description: structural and functional importance of first-shell metal ligands in the binuclear manganese cluster of arginase i.

SCOP Domain Sequences for d1p8pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8pa_ c.42.1.1 (A:) Arginase {Rat (Rattus norvegicus)}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdnsmaigsisgharvhpdlcviwvda
htdintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhkpetdyl

SCOP Domain Coordinates for d1p8pa_:

Click to download the PDB-style file with coordinates for d1p8pa_.
(The format of our PDB-style files is described here.)

Timeline for d1p8pa_: