SCOP 1.65: Domain d1p8mb_: 1p8m B:

Lineage for d1p8mb_ (1p8m B:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (2 families)

5. Family c.42.1.1: Arginase-like amidino hydrolases [52769] (2 proteins)

6. Protein Arginase [52770] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [52771] (18 PDB entries)

8. Domain d1p8mb_: 1p8m B: [87963]

Details for d1p8mb_

PDB Entry: 1p8m, 2.84 Å

PDB Description: structural and functional importance of first-shell metal ligands in the binuclear manganese cluster of arginase i.

SCOP Domain Sequences for d1p8mb_:

Sequence; same for both SEQRES and ATOM records:

>d1p8mb_ c.42.1.1 (B:) Arginase {Rat (Rattus norvegicus)}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
hteintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhkpetdyl

Timeline for d1p8mb_:

• d1p8mb_ is new in SCOP 1.65
  
• d1p8mb_ appears in SCOP 1.67
  
• d1p8mb_ appears in the current release, SCOPe 2.08