Lineage for d1p8ma_ (1p8m A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698273Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 698274Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) (S)
  5. 698275Family c.42.1.1: Arginase-like amidino hydrolases [52769] (4 proteins)
    Pfam PF00491
  6. 698296Protein Arginase [52770] (5 species)
  7. 698346Species Rat (Rattus norvegicus) [TaxId:10116] [52771] (31 PDB entries)
  8. 698413Domain d1p8ma_: 1p8m A: [87962]

Details for d1p8ma_

PDB Entry: 1p8m (more details), 2.84 Å

PDB Description: structural and functional importance of first-shell metal ligands in the binuclear manganese cluster of arginase i.
PDB Compounds: (A:) arginase 1

SCOP Domain Sequences for d1p8ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8ma_ c.42.1.1 (A:) Arginase {Rat (Rattus norvegicus) [TaxId: 10116]}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
hteintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhkpetdyl

SCOP Domain Coordinates for d1p8ma_:

Click to download the PDB-style file with coordinates for d1p8ma_.
(The format of our PDB-style files is described here.)

Timeline for d1p8ma_: