Lineage for d1p8jh2 (1p8j H:110-442)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 990724Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 990725Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 990726Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 990739Protein Furin, N-terminal domain [89694] (1 species)
  7. 990740Species Mouse (Mus musculus) [TaxId:10090] [89695] (1 PDB entry)
  8. 990748Domain d1p8jh2: 1p8j H:110-442 [87961]
    Other proteins in same PDB: d1p8ja1, d1p8jb1, d1p8jc1, d1p8jd1, d1p8je1, d1p8jf1, d1p8jg1, d1p8jh1
    complexed with ca, nag, so4

Details for d1p8jh2

PDB Entry: 1p8j (more details), 2.6 Å

PDB Description: crystal structure of the proprotein convertase furin
PDB Compounds: (H:) Furin precursor

SCOPe Domain Sequences for d1p8jh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8jh2 c.41.1.1 (H:110-442) Furin, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
yqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagnydp
gasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmldg
evtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsif
vwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqnek
qivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlnad
dwatngvgrkvshsygyglldagamvalaqnwt

SCOPe Domain Coordinates for d1p8jh2:

Click to download the PDB-style file with coordinates for d1p8jh2.
(The format of our PDB-style files is described here.)

Timeline for d1p8jh2: