SCOP 1.67: Domain d1p8jg2: 1p8j G:109-442

Lineage for d1p8jg2 (1p8j G:109-442)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (2 families)

5. Family c.41.1.1: Subtilases [52744] (10 proteins)

6. Protein Furin, N-terminal domain [89694] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [89695] (1 PDB entry)

8. Domain d1p8jg2: 1p8j G:109-442 [87959]
   Other proteins in same PDB: d1p8ja1, d1p8jb1, d1p8jc1, d1p8jd1, d1p8je1, d1p8jf1, d1p8jg1, d1p8jh1

Details for d1p8jg2

PDB Entry: 1p8j, 2.6 Å

PDB Description: crystal structure of the proprotein convertase furin

SCOP Domain Sequences for d1p8jg2:

Sequence; same for both SEQRES and ATOM records:

>d1p8jg2 c.41.1.1 (G:109-442) Furin, N-terminal domain {Mouse (Mus musculus)}
vyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagnyd
pgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmld
gevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsi
fvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqne
kqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlna
ddwatngvgrkvshsygyglldagamvalaqnwt

Timeline for d1p8jg2:

• d1p8jg2 first appeared in SCOP 1.65
  
• d1p8jg2 appears in SCOP 1.69
  
• d1p8jg2 appears in the current release, SCOPe 2.08