SCOPe 2.06: Domain d1p8jg1: 1p8j G:443-575

Lineage for d1p8jg1 (1p8j G:443-575)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.20: Proprotein convertase P-domain [89249] (3 proteins)
   a truncated form of this fold lacking one of the N-terminal strands

6. Protein Furin, C-terminal domain [89252] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [89253] (1 PDB entry)

8. Domain d1p8jg1: 1p8j G:443-575 [87958]
   Other proteins in same PDB: d1p8ja2, d1p8jb2, d1p8jc2, d1p8jd2, d1p8je2, d1p8jf2, d1p8jg2, d1p8jh2
   complexed with ca, nag, so4

Details for d1p8jg1

PDB Entry: 1p8j, 2.6 Å

PDB Description: crystal structure of the proprotein convertase furin

PDB Compounds: (G:) Furin precursor

SCOPe Domain Sequences for d1p8jg1:

Sequence; same for both SEQRES and ATOM records:

>d1p8jg1 b.18.1.20 (G:443-575) Furin, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
tvapqrkciveilvepkdigkrlevrkavtaclgepnhitrlehvqarltlsynrrgdla
ihlispmgtrstllaarphdysadgfndwafmtthswdedpagewvleientseannygt
ltkftlvlygtap

Timeline for d1p8jg1:

• d1p8jg1 first appeared in SCOP 1.65
  
• d1p8jg1 appears in SCOPe 2.05
  
• d1p8jg1 appears in SCOPe 2.07
  
• d1p8jg1 appears in the current release, SCOPe 2.08