Lineage for d1p8jf1 (1p8j F:443-575)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 458865Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 458866Superfamily b.18.1: Galactose-binding domain-like [49785] (24 families) (S)
  5. 459190Family b.18.1.20: Proprotein convertase P-domain [89249] (3 proteins)
    a truncated form of this fold lacking one of the N-terminal strands
  6. 459196Protein Furin, C-terminal domain [89252] (1 species)
  7. 459197Species Mouse (Mus musculus) [TaxId:10090] [89253] (1 PDB entry)
  8. 459203Domain d1p8jf1: 1p8j F:443-575 [87956]
    Other proteins in same PDB: d1p8ja2, d1p8jb2, d1p8jc2, d1p8jd2, d1p8je2, d1p8jf2, d1p8jg2, d1p8jh2

Details for d1p8jf1

PDB Entry: 1p8j (more details), 2.6 Å

PDB Description: crystal structure of the proprotein convertase furin

SCOP Domain Sequences for d1p8jf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8jf1 b.18.1.20 (F:443-575) Furin, C-terminal domain {Mouse (Mus musculus)}
tvapqrkciveilvepkdigkrlevrkavtaclgepnhitrlehvqarltlsynrrgdla
ihlispmgtrstllaarphdysadgfndwafmtthswdedpagewvleientseannygt
ltkftlvlygtap

SCOP Domain Coordinates for d1p8jf1:

Click to download the PDB-style file with coordinates for d1p8jf1.
(The format of our PDB-style files is described here.)

Timeline for d1p8jf1: