Lineage for d1p8da_ (1p8d A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008914Protein Oxysterols receptor LXR-beta [89149] (1 species)
  7. 2008915Species Human (Homo sapiens) [TaxId:9606] [89150] (6 PDB entries)
    Uniprot P55055 219-461
  8. 2008930Domain d1p8da_: 1p8d A: [87941]
    complexed with a co-activator peptide, chains C and D
    complexed with co1

Details for d1p8da_

PDB Entry: 1p8d (more details), 2.8 Å

PDB Description: x-ray crystal structure of lxr ligand binding domain with 24(s),25- epoxycholesterol
PDB Compounds: (A:) oxysterols receptor lxr-beta

SCOPe Domain Sequences for d1p8da_:

Sequence, based on SEQRES records: (download)

>d1p8da_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]}
vqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdarqqrfahftelaii
svqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftysk
ddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqq
pyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiw
dvhe

Sequence, based on observed residues (ATOM records): (download)

>d1p8da_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]}
vqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplqsrdarqqrfahftelaiisvqe
ivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfh
raglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyve
allsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdvhe

SCOPe Domain Coordinates for d1p8da_:

Click to download the PDB-style file with coordinates for d1p8da_.
(The format of our PDB-style files is described here.)

Timeline for d1p8da_: