Lineage for d1p87q_ (1p87 Q:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896398Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 896514Domain d1p87q_: 1p87 Q: [87937]
    30S subunit fit in the cryo-EM map of 70S ribosome

Details for d1p87q_

PDB Entry: 1p87 (more details), 11.5 Å

PDB Description: Real space refined coordinates of the 30S subunit fitted into the low resolution cryo-EM map of the initiation-like state of E. coli 70S ribosome
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOP Domain Sequences for d1p87q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p87q_ i.1.1.1 (Q:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
rtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveirecr
plsktkswtlvrvvekavl

SCOP Domain Coordinates for d1p87q_:

Click to download the PDB-style file with coordinates for d1p87q_.
(The format of our PDB-style files is described here.)

Timeline for d1p87q_: