Class i: Low resolution protein structures [58117] (26 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
Domain d1p87q_: 1p87 Q: [87937] 30S subunit fit in the cryo-EM map of 70S ribosome |
PDB Entry: 1p87 (more details), 11.5 Å
SCOP Domain Sequences for d1p87q_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p87q_ i.1.1.1 (Q:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} rtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveirecr plsktkswtlvrvvekavl
Timeline for d1p87q_: