Lineage for d1p87o_ (1p87 O:)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1069523Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1069524Protein 70S ribosome functional complex [58121] (9 species)
  7. 1069596Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1069716Domain d1p87o_: 1p87 O: [87935]
    30S subunit fit in the cryo-EM map of 70S ribosome

Details for d1p87o_

PDB Entry: 1p87 (more details), 11.5 Å

PDB Description: Real space refined coordinates of the 30S subunit fitted into the low resolution cryo-EM map of the initiation-like state of E. coli 70S ribosome
PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d1p87o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p87o_ i.1.1.1 (O:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
lsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmvsq
rrklldylkrkdvarytqlierlglr

SCOPe Domain Coordinates for d1p87o_:

Click to download the PDB-style file with coordinates for d1p87o_.
(The format of our PDB-style files is described here.)

Timeline for d1p87o_: