Lineage for d1p87c_ (1p87 C:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 753710Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 753711Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 753712Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 753713Protein 70S ribosome functional complex [58121] (3 species)
  7. 753759Species Escherichia coli [TaxId:562] [58123] (34 PDB entries)
  8. 754077Domain d1p87c_: 1p87 C: [87923]

Details for d1p87c_

PDB Entry: 1p87 (more details)

PDB Description: Real space refined coordinates of the 30S subunit fitted into the low resolution cryo-EM map of the initiation-like state of E. coli 70S ribosome
PDB Compounds: (C:) 30S ribosomal protein S3

SCOP Domain Sequences for d1p87c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p87c_ i.1.1.1 (C:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaevrkpeldaklvadsit
sqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiartewyregrvplhtlrad
idyntseahttygvigvkvwifkgei

SCOP Domain Coordinates for d1p87c_:

Click to download the PDB-style file with coordinates for d1p87c_.
(The format of our PDB-style files is described here.)

Timeline for d1p87c_: