Lineage for d1p86u_ (1p86 U:)

  1. Root: SCOP 1.69
  2. 526321Class i: Low resolution protein structures [58117] (24 folds)
  3. 526322Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 526323Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 526324Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 526325Protein 70S ribosome functional complex [58121] (3 species)
  7. 526374Species Escherichia coli [TaxId:562] [58123] (29 PDB entries)
  8. 526625Domain d1p86u_: 1p86 U: [87917]

Details for d1p86u_

PDB Entry: 1p86 (more details)

PDB Description: Real space refined coordinates of the 50S subunit fitted into the low resolution cryo-EM map of the initiation-like state of E. coli 70S ribosome
PDB Compounds: (U:)

SCOP Domain Sequences for d1p86u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p86u_ i.1.1.1 (U:) 70S ribosome functional complex {Escherichia coli}
akrlgvkrfggesvlagsiivrqrgtkfhaganvgcgrdhtlfakadgkvkfevkgpknr
kfisieae

SCOP Domain Coordinates for d1p86u_:

Click to download the PDB-style file with coordinates for d1p86u_.
(The format of our PDB-style files is described here.)

Timeline for d1p86u_: