SCOP 1.69: Domain d1p86o_: 1p86 O:

Lineage for d1p86o_ (1p86 O:)

1. Root: SCOP 1.69

2. Class i: Low resolution protein structures [58117] (24 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (3 species)

7. Species Escherichia coli [TaxId:562] [58123] (29 PDB entries)

8. Domain d1p86o_: 1p86 O: [87912]

Details for d1p86o_

PDB Entry: 1p86

PDB Description: Real space refined coordinates of the 50S subunit fitted into the low resolution cryo-EM map of the initiation-like state of E. coli 70S ribosome

SCOP Domain Sequences for d1p86o_:

Sequence; same for both SEQRES and ATOM records:

>d1p86o_ i.1.1.1 (O:) 70S ribosome functional complex {Escherichia coli}
rrqrkrqfrqlwiarinaaarqngisyskfinglkkasveidrkiladiavfdkvaftal
vekakaal

Timeline for d1p86o_:

• d1p86o_ first appeared in SCOP 1.65
  
• d1p86o_ appears in SCOP 1.67
  
• d1p86o_ appears in SCOP 1.71
  
• d1p86o_ appears in the current release, SCOPe 2.08