![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
![]() | Protein 70S ribosome functional complex [58121] (9 species) |
![]() | Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
![]() | Domain d1p86k_: 1p86 K: [87908] 50S subunit fit in the cryo-EM map of 70S ribosome |
PDB Entry: 1p86 (more details), 11.5 Å
SCOPe Domain Sequences for d1p86k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p86k_ i.1.1.1 (K:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} qpkrtkfrkmhkgrnrglaqgtdvsfgsfglkavgrgrltarqieaarramtravkrqgk iwirvfpdkpitekplavrmgkgkgnveywvaliqpgkvlyemdgvpeelareafklaaa klpikttfvtk
Timeline for d1p86k_: