Lineage for d1p86j_ (1p86 J:)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2268317Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2268318Protein 70S ribosome functional complex [58121] (4 species)
  7. 2268319Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 2268436Domain d1p86j_: 1p86 J: [87907]
    50S subunit fit in the cryo-EM map of 70S ribosome

Details for d1p86j_

PDB Entry: 1p86 (more details), 11.5 Å

PDB Description: Real space refined coordinates of the 50S subunit fitted into the low resolution cryo-EM map of the initiation-like state of E. coli 70S ribosome
PDB Compounds: (J:) 50S ribosomal protein L15

SCOPe Domain Sequences for d1p86j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p86j_ i.1.1.1 (J:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
taeirlsdlakveggvvdlntlkaaniigiqiefakvilagevttpvtvrglrvtkgara
aieaaggkie

SCOPe Domain Coordinates for d1p86j_:

Click to download the PDB-style file with coordinates for d1p86j_.
(The format of our PDB-style files is described here.)

Timeline for d1p86j_: