Class i: Low resolution protein structures [58117] (24 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (3 species) |
Species Escherichia coli [TaxId:562] [58123] (39 PDB entries) |
Domain d1p86h_: 1p86 H: [87905] |
PDB Entry: 1p86 (more details)
SCOP Domain Sequences for d1p86h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p86h_ i.1.1.1 (H:) 70S ribosome functional complex {Escherichia coli} mktftakpetvkrdwyvvdatgktlgrlatelarrlrgkhkaeytphvdtgdyiivlnad kvavtgnkrtdkvyyhhtghiggikqatfeemiarrpervieiavkgmlpkgplgramfr klkvyagnehnhaaqqpqvldi
Timeline for d1p86h_:
View in 3D Domains from other chains: (mouse over for more information) d1p860_, d1p861_, d1p864_, d1p866_, d1p869_, d1p86a_, d1p86b_, d1p86c_, d1p86d_, d1p86e_, d1p86f_, d1p86g_, d1p86i_, d1p86j_, d1p86k_, d1p86l_, d1p86m_, d1p86n_, d1p86o_, d1p86q_, d1p86r_, d1p86s_, d1p86t_, d1p86u_, d1p86w_, d1p86x_, d1p86z_ |