SCOP 1.71: Domain d1p85u_: 1p85 U:

Lineage for d1p85u_ (1p85 U:)

1. Root: SCOP 1.71

2. Class i: Low resolution protein structures [58117] (24 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (3 species)

7. Species Escherichia coli [TaxId:562] [58123] (39 PDB entries)

8. Domain d1p85u_: 1p85 U: [87889]

Details for d1p85u_

PDB Entry: 1p85

PDB Description: Real space refined coordinates of the 50S subunit fitted into the low resolution cryo-EM map of the EF-G.GTP state of E. coli 70S ribosome

SCOP Domain Sequences for d1p85u_:

Sequence; same for both SEQRES and ATOM records:

>d1p85u_ i.1.1.1 (U:) 70S ribosome functional complex {Escherichia coli}
akrlgvkrfggesvlagsiivrqrgtkfhaganvgcgrdhtlfakadgkvkfevkgpknr
kfisieae

Timeline for d1p85u_:

• d1p85u_ first appeared in SCOP 1.65
  
• d1p85u_ appears in SCOP 1.69
  
• d1p85u_ appears in SCOP 1.73
  
• d1p85u_ appears in the current release, SCOPe 2.08