Lineage for d1p84i_ (1p84 I:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254512Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 2254513Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 2254514Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    interacts with cytochrome c1 and ISP
  7. 2254515Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81511] (4 PDB entries)
  8. 2254518Domain d1p84i_: 1p84 I: [87863]
    Other proteins in same PDB: d1p84a1, d1p84a2, d1p84b1, d1p84b2, d1p84c1, d1p84c2, d1p84d1, d1p84d2, d1p84e1, d1p84e2, d1p84f_, d1p84g_, d1p84h_, d1p84j_, d1p84k_
    complexed with 3pe, 3ph, cdl, dbt, fes, hem, pc1, umq, uq6

Details for d1p84i_

PDB Entry: 1p84 (more details), 2.5 Å

PDB Description: hdbt inhibited yeast cytochrome bc1 complex
PDB Compounds: (I:) Ubiquinol-cytochrome c reductase complex 7.3 kDa protein

SCOPe Domain Sequences for d1p84i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p84i_ f.23.14.1 (I:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa

SCOPe Domain Coordinates for d1p84i_:

Click to download the PDB-style file with coordinates for d1p84i_.
(The format of our PDB-style files is described here.)

Timeline for d1p84i_: