![]() | Class f: Membrane and cell surface proteins and peptides [56835] (49 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
![]() | Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) ![]() |
![]() | Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein) |
![]() | Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species) interacts with cytochrome c1 and ISP |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81511] (4 PDB entries) |
![]() | Domain d1p84i_: 1p84 I: [87863] Other proteins in same PDB: d1p84a1, d1p84a2, d1p84b1, d1p84b2, d1p84c1, d1p84c2, d1p84d1, d1p84d2, d1p84e1, d1p84e2, d1p84f_, d1p84g_, d1p84h_, d1p84j_, d1p84k_ complexed with 3pe, 3ph, cdl, dbt, fes, hem, pc1, umq, uq6 |
PDB Entry: 1p84 (more details), 2.5 Å
SCOP Domain Sequences for d1p84i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p84i_ f.23.14.1 (I:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae)} sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa
Timeline for d1p84i_: