Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) automatically mapped to Pfam PF02939 |
Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins) |
Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species) together with cytochrome b binds to ubiquinone |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81505] (10 PDB entries) |
Domain d1p84h_: 1p84 H: [87862] Other proteins in same PDB: d1p84a1, d1p84a2, d1p84b1, d1p84b2, d1p84c1, d1p84c2, d1p84d1, d1p84d2, d1p84e1, d1p84e2, d1p84f_, d1p84g_, d1p84i_, d1p84j_, d1p84k_ complexed with 3pe, 3ph, cdl, dbt, fes, hem, pc1, umq, uq6 |
PDB Entry: 1p84 (more details), 2.5 Å
SCOPe Domain Sequences for d1p84h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p84h_ f.23.13.1 (H:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli pagiywywwkngneyneflyskagreelervnv
Timeline for d1p84h_: