![]() | Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
![]() | Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
![]() | Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) ![]() location - matrix side of the bc1 complex |
![]() | Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (1 protein) probably important for the complex assembly, caps the matrix face of cytochrome b |
![]() | Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81521] (5 PDB entries) |
![]() | Domain d1p84g_: 1p84 G: [87861] Other proteins in same PDB: d1p84a1, d1p84a2, d1p84b1, d1p84b2, d1p84c1, d1p84c2, d1p84d1, d1p84d2, d1p84e1, d1p84e2, d1p84f_, d1p84h_, d1p84i_, d1p84j_, d1p84k_ complexed with 3pe, 3ph, cdl, dbt, fes, hem, pc1, umq, uq6 |
PDB Entry: 1p84 (more details), 2.5 Å
SCOP Domain Sequences for d1p84g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p84g_ f.27.1.1 (G:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} qsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalrr lpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeldn ievsk
Timeline for d1p84g_: