![]() | Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
![]() | Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) ![]() |
![]() | Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins) |
![]() | Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81499] (5 PDB entries) |
![]() | Domain d1p84e2: 1p84 E:31-86 [87859] Other proteins in same PDB: d1p84a1, d1p84a2, d1p84b1, d1p84b2, d1p84c1, d1p84c2, d1p84d1, d1p84d2, d1p84e1, d1p84f_, d1p84g_, d1p84h_, d1p84i_, d1p84j_, d1p84k_ complexed with 3pe, 3ph, cdl, dbt, fes, hem, pc1, umq, uq6 |
PDB Entry: 1p84 (more details), 2.5 Å
SCOP Domain Sequences for d1p84e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p84e2 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtata
Timeline for d1p84e2: