Lineage for d1p84e2 (1p84 E:31-86)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745533Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 745875Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) (S)
  5. 745876Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 745877Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)
  7. 745878Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81499] (5 PDB entries)
  8. 745882Domain d1p84e2: 1p84 E:31-86 [87859]
    Other proteins in same PDB: d1p84a1, d1p84a2, d1p84b1, d1p84b2, d1p84c1, d1p84c2, d1p84d1, d1p84d2, d1p84e1, d1p84f_, d1p84g_, d1p84h_, d1p84i_, d1p84j_, d1p84k_
    complexed with 3pe, 3ph, cdl, dbt, fes, hem, pc1, umq, uq6

Details for d1p84e2

PDB Entry: 1p84 (more details), 2.5 Å

PDB Description: hdbt inhibited yeast cytochrome bc1 complex
PDB Compounds: (E:) ubiquinol-cytochrome c reductase iron-sulfur subunit

SCOP Domain Sequences for d1p84e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p84e2 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtata

SCOP Domain Coordinates for d1p84e2:

Click to download the PDB-style file with coordinates for d1p84e2.
(The format of our PDB-style files is described here.)

Timeline for d1p84e2: