SCOPe 2.01: Domain d1p84d1: 1p84 D:62-260

Lineage for d1p84d1 (1p84 D:62-260)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein)

6. Protein Cytochrome bc1 domain [46677] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63462] (7 PDB entries)

8. Domain d1p84d1: 1p84 D:62-260 [87856]
   Other proteins in same PDB: d1p84a1, d1p84a2, d1p84b1, d1p84b2, d1p84c1, d1p84c2, d1p84d2, d1p84e1, d1p84e2, d1p84f_, d1p84g_, d1p84h_, d1p84i_, d1p84j_, d1p84k_
   complexed with 3pe, 3ph, cdl, dbt, fes, hem, pc1, umq, uq6

Details for d1p84d1

PDB Entry: 1p84, 2.5 Å

PDB Description: hdbt inhibited yeast cytochrome bc1 complex

PDB Compounds: (D:) cytochrome c1, heme protein

SCOPe Domain Sequences for d1p84d1:

Sequence; same for both SEQRES and ATOM records:

>d1p84d1 a.3.1.3 (D:62-260) Cytochrome bc1 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
attsqmakdvttflnwcae

Timeline for d1p84d1:

• d1p84d1 first appeared in SCOP 1.65
  
• d1p84d1 appears in SCOP 1.75
  
• d1p84d1 appears in SCOPe 2.02
  
• d1p84d1 appears in the current release, SCOPe 2.08