![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (8 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein) |
![]() | Protein Cytochrome bc1 domain [46677] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63462] (4 PDB entries) |
![]() | Domain d1p84d1: 1p84 D:62-260 [87856] Other proteins in same PDB: d1p84a1, d1p84a2, d1p84b1, d1p84b2, d1p84c1, d1p84c2, d1p84d2, d1p84e1, d1p84e2, d1p84f_, d1p84g_, d1p84h_, d1p84i_, d1p84j_, d1p84k_ complexed with 3pe, 3ph, cdl, dbt, fes, hem, pc1, umq, uq6 |
PDB Entry: 1p84 (more details), 2.5 Å
SCOP Domain Sequences for d1p84d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p84d1 a.3.1.3 (D:62-260) Cytochrome bc1 domain {Baker's yeast (Saccharomyces cerevisiae)} mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp attsqmakdvttflnwcae
Timeline for d1p84d1: