Lineage for d1p84c1 (1p84 C:262-385)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 888181Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 888182Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) (S)
  5. 888183Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 888184Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 888185Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81645] (7 PDB entries)
  8. 888193Domain d1p84c1: 1p84 C:262-385 [87854]
    Other proteins in same PDB: d1p84a1, d1p84a2, d1p84b1, d1p84b2, d1p84c2, d1p84d1, d1p84d2, d1p84e1, d1p84e2, d1p84f_, d1p84g_, d1p84h_, d1p84i_, d1p84j_, d1p84k_
    complexed with 3pe, 3ph, cdl, dbt, fes, hem, pc1, umq, uq6

Details for d1p84c1

PDB Entry: 1p84 (more details), 2.5 Å

PDB Description: hdbt inhibited yeast cytochrome bc1 complex
PDB Compounds: (C:) cytochrome b

SCOP Domain Sequences for d1p84c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p84c1 f.32.1.1 (C:262-385) Mitochondrial cytochrome b subunit, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl
skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig
rvnk

SCOP Domain Coordinates for d1p84c1:

Click to download the PDB-style file with coordinates for d1p84c1.
(The format of our PDB-style files is described here.)

Timeline for d1p84c1: