Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Inward rectifier potassium channel Kirbac1.1 [90109] (1 species) |
Species Burkholderia pseudomallei [TaxId:28450] [90110] (1 PDB entry) |
Domain d1p7bb2: 1p7b B:36-151 [87847] Other proteins in same PDB: d1p7ba1, d1p7bb1 complexed with k |
PDB Entry: 1p7b (more details), 3.65 Å
SCOPe Domain Sequences for d1p7bb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p7bb2 f.14.1.1 (B:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} reviaygmpasvwrdlyywalkvswpvffaslaalfvvnntlfallyqlgdapianqspp gfvgafffsvetlatvgygdmhpqtvyahaiatleifvgmsgialstglvfarfar
Timeline for d1p7bb2: