Lineage for d1p7bb2 (1p7b B:36-151)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 619951Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 619952Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 619953Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)
  6. 619954Protein Inward rectifier potassium channel Kirbac1.1 [90109] (1 species)
  7. 619955Species Burkholderia pseudomallei [TaxId:28450] [90110] (1 PDB entry)
  8. 619957Domain d1p7bb2: 1p7b B:36-151 [87847]
    Other proteins in same PDB: d1p7ba1, d1p7bb1
    complexed with k

Details for d1p7bb2

PDB Entry: 1p7b (more details), 3.65 Å

PDB Description: Crystal structure of an inward rectifier potassium channel

SCOP Domain Sequences for d1p7bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7bb2 f.14.1.1 (B:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei}
reviaygmpasvwrdlyywalkvswpvffaslaalfvvnntlfallyqlgdapianqspp
gfvgafffsvetlatvgygdmhpqtvyahaiatleifvgmsgialstglvfarfar

SCOP Domain Coordinates for d1p7bb2:

Click to download the PDB-style file with coordinates for d1p7bb2.
(The format of our PDB-style files is described here.)

Timeline for d1p7bb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p7bb1