![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) ![]() |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins) |
![]() | Protein Inward rectifier potassium channel Kirbac1.1 [90109] (1 species) |
![]() | Species Burkholderia pseudomallei [TaxId:28450] [90110] (1 PDB entry) |
![]() | Domain d1p7ba2: 1p7b A:36-151 [87845] Other proteins in same PDB: d1p7ba1, d1p7bb1 |
PDB Entry: 1p7b (more details), 3.65 Å
SCOP Domain Sequences for d1p7ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} reviaygmpasvwrdlyywalkvswpvffaslaalfvvnntlfallyqlgdapianqspp gfvgafffsvetlatvgygdmhpqtvyahaiatleifvgmsgialstglvfarfar
Timeline for d1p7ba2: