Lineage for d1p7ba2 (1p7b A:36-151)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340499Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 340500Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 340501Family f.14.1.1: Voltage-gated potassium channels [81323] (4 proteins)
  6. 340502Protein Inward rectifier potassium channel Kirbac1.1 [90109] (1 species)
  7. 340503Species Burkholderia pseudomallei [TaxId:28450] [90110] (1 PDB entry)
  8. 340504Domain d1p7ba2: 1p7b A:36-151 [87845]
    Other proteins in same PDB: d1p7ba1, d1p7bb1

Details for d1p7ba2

PDB Entry: 1p7b (more details), 3.65 Å

PDB Description: Crystal structure of an inward rectifier potassium channel

SCOP Domain Sequences for d1p7ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei}
reviaygmpasvwrdlyywalkvswpvffaslaalfvvnntlfallyqlgdapianqspp
gfvgafffsvetlatvgygdmhpqtvyahaiatleifvgmsgialstglvfarfar

SCOP Domain Coordinates for d1p7ba2:

Click to download the PDB-style file with coordinates for d1p7ba2.
(The format of our PDB-style files is described here.)

Timeline for d1p7ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p7ba1