![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (20 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (3 proteins) |
![]() | Protein Inward rectifier potassium channel Kirbac1.1 [89195] (1 species) |
![]() | Species Burkholderia pseudomallei [TaxId:28450] [89196] (1 PDB entry) |
![]() | Domain d1p7ba1: 1p7b A:152-309 [87844] Other proteins in same PDB: d1p7ba2, d1p7bb2 |
PDB Entry: 1p7b (more details), 3.65 Å
SCOP Domain Sequences for d1p7ba1:
Sequence, based on SEQRES records: (download)
>d1p7ba1 b.1.18.16 (A:152-309) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} prakimfarhaivrpfngrmtlmvraanarqnviaearakmrlmrrehssegyslmkihd lklvrnehpifllgwnmmhvidessplfgetpeslaegramllvmiegsdettaqvmqar hawehddirwhhryvdlmsdvdgmthidytrfndtepv
>d1p7ba1 b.1.18.16 (A:152-309) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} prakimfarhaivrpfngrmtlmvraanarqnviaearakmrlmlmkihdlklvrnehpi fllgwnmmhvidessplfgetpeslaegramllvmiegsdettaqvmqarhawehddirw hhryvdlmthidytrfndtepv
Timeline for d1p7ba1: