Lineage for d1p71b_ (1p71 B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539168Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 539169Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (2 families) (S)
    dimer of identical subunits
  5. 539170Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins)
  6. 539171Protein HU protein [47735] (4 species)
  7. 539172Species Anabaena sp. [89074] (3 PDB entries)
  8. 539174Domain d1p71b_: 1p71 B: [87841]

Details for d1p71b_

PDB Entry: 1p71 (more details), 1.9 Å

PDB Description: Anabaena HU-DNA corcrystal structure (TR3)

SCOP Domain Sequences for d1p71b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p71b_ a.55.1.1 (B:) HU protein {Anabaena sp.}
mnkgelvdavaekasvtkkqadavltaaletiieavssgdkvtlvgfgsfesrerkareg
rnpktnekmeipatrvpafsagklfrekvappk

SCOP Domain Coordinates for d1p71b_:

Click to download the PDB-style file with coordinates for d1p71b_.
(The format of our PDB-style files is described here.)

Timeline for d1p71b_:

539174
d1p71b_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1p71a_