SCOPe 2.05: Domain d1p6pa_: 1p6p A:

Lineage for d1p6pa_ (1p6p A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Liver basic fatty acid binding protein, LB_FABP [89368] (3 species)

7. Species Argentine common toad (Bufo arenarum) [TaxId:38577] [89370] (1 PDB entry)

8. Domain d1p6pa_: 1p6p A: [87839]

Details for d1p6pa_

PDB Entry: 1p6p, 2.5 Å

PDB Description: crystal structure of toad liver basic fatty acid-binding protein

PDB Compounds: (A:) Fatty acid-binding protein, liver

SCOPe Domain Sequences for d1p6pa_:

Sequence; same for both SEQRES and ATOM records:

>d1p6pa_ b.60.1.2 (A:) Liver basic fatty acid binding protein, LB_FABP {Argentine common toad (Bufo arenarum) [TaxId: 38577]}
afngtwnvyaqenyenflrtvglpediikvakdvnpvieieqngnefvvtsktpkqthsn
sftvgkeseitsmdgkkikvtvqleggklicksdkfshiqevngdemvekitigsstltr
kskrv

Timeline for d1p6pa_:

• d1p6pa_ first appeared in SCOP 1.65
  
• d1p6pa_ appears in SCOPe 2.04
  
• d1p6pa_ appears in SCOPe 2.06
  
• d1p6pa_ appears in the current release, SCOPe 2.08