SCOP 1.75: Domain d1p6gn_: 1p6g N:

Lineage for d1p6gn_ (1p6g N:)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (9 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d1p6gn_: 1p6g N: [87832]
   30S subunit fit in the cryo-EM map of 70S ribosome

Details for d1p6gn_

PDB Entry: 1p6g, 12.3 Å

PDB Description: Real space refined coordinates of the 30S subunit fitted into the low resolution cryo-EM map of the EF-G.GTP state of E. coli 70S ribosome

PDB Compounds: (N:) 30S ribosomal protein S14

SCOP Domain Sequences for d1p6gn_:

Sequence; same for both SEQRES and ATOM records:

>d1p6gn_ i.1.1.1 (N:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
phgflrkfglsrikvreaamrgeipglkkasw

Timeline for d1p6gn_:

• d1p6gn_ first appeared in SCOP 1.65
  
• d1p6gn_ appears in SCOP 1.73
  
• d1p6gn_ appears in SCOPe 2.01
  
• d1p6gn_ appears in the current release, SCOPe 2.08