Lineage for d1p6gc_ (1p6g C:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 432184Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 432185Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 432186Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 432187Protein 70S ribosome functional complex [58121] (2 species)
  7. 432188Species Escherichia coli [TaxId:562] [58123] (27 PDB entries)
  8. 432370Domain d1p6gc_: 1p6g C: [87821]

Details for d1p6gc_

PDB Entry: 1p6g (more details)

PDB Description: Real space refined coordinates of the 30S subunit fitted into the low resolution cryo-EM map of the EF-G.GTP state of E. coli 70S ribosome

SCOP Domain Sequences for d1p6gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p6gc_ i.1.1.1 (C:) 70S ribosome functional complex {Escherichia coli}
gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaevrkpeldaklvadsit
sqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiartewyregrvplhtlrad
idyntseahttygvigvkvwifkgei

SCOP Domain Coordinates for d1p6gc_:

Click to download the PDB-style file with coordinates for d1p6gc_.
(The format of our PDB-style files is described here.)

Timeline for d1p6gc_: