Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein Deoxycytidine kinase [89657] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89658] (45 PDB entries) |
Domain d1p60a_: 1p60 A: [87816] complexed with adp, dcz |
PDB Entry: 1p60 (more details), 1.96 Å
SCOPe Domain Sequences for d1p60a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p60a_ c.37.1.1 (A:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} trikkisiegniaagkstfvnilkqlcedwevvpepvarwcnvqstqdefeeltmsqkng gnvlqmmyekperwsftfqtyaclsriraqlaslngklkdaekpvlffersvysdryifa snlyesecmnetewtiyqdwhdwmnnqfgqsleldgiiylqatpetclhriylrgrneeq gipleyleklhykheswllhrtlktnfdylqevpiltldvnedfkdkyeslvekvkefls tl
Timeline for d1p60a_: