Lineage for d1p5vb_ (1p5v B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 789808Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 789904Superfamily b.2.3: Bacterial adhesins [49401] (6 families) (S)
  5. 789909Family b.2.3.2: Pilus subunits [49405] (8 proteins)
  6. 789910Protein F1 capsule antigen Caf1 [89213] (1 species)
  7. 789911Species Yersinia pestis [TaxId:632] [89214] (3 PDB entries)
  8. 789912Domain d1p5vb_: 1p5v B: [87814]
    Other proteins in same PDB: d1p5va1, d1p5va2

Details for d1p5vb_

PDB Entry: 1p5v (more details), 1.7 Å

PDB Description: x-ray structure of the caf1m:caf1 chaperone:subunit preassembly complex
PDB Compounds: (B:) F1 capsule antigen

SCOP Domain Sequences for d1p5vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p5vb_ b.2.3.2 (B:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
veparitltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmylt
ftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggkl
aagkytdavtvtvsnq

SCOP Domain Coordinates for d1p5vb_:

Click to download the PDB-style file with coordinates for d1p5vb_.
(The format of our PDB-style files is described here.)

Timeline for d1p5vb_: