| Class b: All beta proteins [48724] (165 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (6 families) ![]() |
| Family b.2.3.2: Pilus subunits [49405] (5 proteins) |
| Protein F1 capsule antigen Caf1 [89213] (1 species) |
| Species Yersinia pestis [TaxId:632] [89214] (2 PDB entries) |
| Domain d1p5vb_: 1p5v B: [87814] Other proteins in same PDB: d1p5va1, d1p5va2 |
PDB Entry: 1p5v (more details), 1.7 Å
SCOP Domain Sequences for d1p5vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p5vb_ b.2.3.2 (B:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
veparitltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmylt
ftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggkl
aagkytdavtvtvsnq
Timeline for d1p5vb_: