Lineage for d1p5va2 (1p5v A:148-233)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792147Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 792269Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) (S)
  5. 792270Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 792271Protein Caf1m [89221] (1 species)
    chaperone of F1 capsule antigen Caf1
  7. 792272Species Yersinia pestis [TaxId:632] [89222] (4 PDB entries)
  8. 792273Domain d1p5va2: 1p5v A:148-233 [87813]
    Other proteins in same PDB: d1p5va1, d1p5vb_

Details for d1p5va2

PDB Entry: 1p5v (more details), 1.7 Å

PDB Description: x-ray structure of the caf1m:caf1 chaperone:subunit preassembly complex
PDB Compounds: (A:) Chaperone protein Caf1M

SCOP Domain Sequences for d1p5va2:

Sequence, based on SEQRES records: (download)

>d1p5va2 b.7.2.1 (A:148-233) Caf1m {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg
lagarnvswriindqggldrlysknv

Sequence, based on observed residues (ATOM records): (download)

>d1p5va2 b.7.2.1 (A:148-233) Caf1m {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpnv
swriindqggldrlysknv

SCOP Domain Coordinates for d1p5va2:

Click to download the PDB-style file with coordinates for d1p5va2.
(The format of our PDB-style files is described here.)

Timeline for d1p5va2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p5va1
View in 3D
Domains from other chains:
(mouse over for more information)
d1p5vb_