Lineage for d1p5va1 (1p5v A:7-147)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111327Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 1111328Family b.1.11.1: Pilus chaperone [49355] (5 proteins)
  6. 1111329Protein Chaperone protein Caf1m [89205] (1 species)
  7. 1111330Species Yersinia pestis [TaxId:632] [89206] (4 PDB entries)
  8. 1111331Domain d1p5va1: 1p5v A:7-147 [87812]
    Other proteins in same PDB: d1p5va2, d1p5vb_

Details for d1p5va1

PDB Entry: 1p5v (more details), 1.7 Å

PDB Description: x-ray structure of the caf1m:caf1 chaperone:subunit preassembly complex
PDB Compounds: (A:) Chaperone protein Caf1M

SCOPe Domain Sequences for d1p5va1:

Sequence, based on SEQRES records: (download)

>d1p5va1 b.1.11.1 (A:7-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
faskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpp
lfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpdkdv
gvfvqfainncikllvrpnel

Sequence, based on observed residues (ATOM records): (download)

>d1p5va1 b.1.11.1 (A:7-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
faskeygvtigesriiypldaagvmvsvkntqdypvliqsriydpfvvtpplfrldakqq
nslriaqaggvfprdkeslkwlcvkgipkdvgvfvqfainncikllvrpnel

SCOPe Domain Coordinates for d1p5va1:

Click to download the PDB-style file with coordinates for d1p5va1.
(The format of our PDB-style files is described here.)

Timeline for d1p5va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p5va2
View in 3D
Domains from other chains:
(mouse over for more information)
d1p5vb_