SCOPe 2.08: Domain d1p5va1: 1p5v A:7-147

Lineage for d1p5va1 (1p5v A:7-147)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
   automatically mapped to Pfam PF00345

6. Protein Chaperone protein Caf1m [89205] (1 species)

7. Species Yersinia pestis [TaxId:632] [89206] (8 PDB entries)

8. Domain d1p5va1: 1p5v A:7-147 [87812]
   Other proteins in same PDB: d1p5va2, d1p5vb_

Details for d1p5va1

PDB Entry: 1p5v, 1.7 Å

PDB Description: x-ray structure of the caf1m:caf1 chaperone:subunit preassembly complex

PDB Compounds: (A:) Chaperone protein Caf1M

SCOPe Domain Sequences for d1p5va1:

Sequence, based on SEQRES records:

>d1p5va1 b.1.11.1 (A:7-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
faskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpp
lfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpdkdv
gvfvqfainncikllvrpnel

Sequence, based on observed residues (ATOM records):

>d1p5va1 b.1.11.1 (A:7-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
faskeygvtigesriiypldaagvmvsvkntqdypvliqsriydpfvvtpplfrldakqq
nslriaqaggvfprdkeslkwlcvkgipkdvgvfvqfainncikllvrpnel

Timeline for d1p5va1:

• d1p5va1 first appeared in SCOP 1.65
  
• d1p5va1 appears in SCOPe 2.07