Lineage for d1p5uc_ (1p5u C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1112569Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1112704Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1112709Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1112710Protein F1 capsule antigen Caf1 [89213] (1 species)
  7. 1112711Species Yersinia pestis [TaxId:632] [89214] (6 PDB entries)
  8. 1112715Domain d1p5uc_: 1p5u C: [87811]
    Other proteins in same PDB: d1p5ua1, d1p5ua2

Details for d1p5uc_

PDB Entry: 1p5u (more details), 1.99 Å

PDB Description: x-ray structure of the ternary caf1m:caf1:caf1 chaperone:subunit:subunit complex
PDB Compounds: (C:) F1 capsule antigen

SCOPe Domain Sequences for d1p5uc_:

Sequence, based on SEQRES records: (download)

>d1p5uc_ b.2.3.2 (C:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
paritltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltft
sqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggklaa
gkytdavtvtvsnq

Sequence, based on observed residues (ATOM records): (download)

>d1p5uc_ b.2.3.2 (C:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
paritltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltft
sqdgnnhqfttkvigkdsrdfdispkvngendvvlatgsqdffvrsigskggklaagkyt
davtvtvsnq

SCOPe Domain Coordinates for d1p5uc_:

Click to download the PDB-style file with coordinates for d1p5uc_.
(The format of our PDB-style files is described here.)

Timeline for d1p5uc_: