SCOPe 2.01: Domain d1p5uc_: 1p5u C:

Lineage for d1p5uc_ (1p5u C:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (9 proteins)

6. Protein F1 capsule antigen Caf1 [89213] (1 species)

7. Species Yersinia pestis [TaxId:632] [89214] (3 PDB entries)

8. Domain d1p5uc_: 1p5u C: [87811]
   Other proteins in same PDB: d1p5ua1, d1p5ua2

Details for d1p5uc_

PDB Entry: 1p5u, 1.99 Å

PDB Description: x-ray structure of the ternary caf1m:caf1:caf1 chaperone:subunit:subunit complex

PDB Compounds: (C:) F1 capsule antigen

SCOPe Domain Sequences for d1p5uc_:

Sequence, based on SEQRES records:

>d1p5uc_ b.2.3.2 (C:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
paritltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltft
sqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggklaa
gkytdavtvtvsnq

Sequence, based on observed residues (ATOM records):

>d1p5uc_ b.2.3.2 (C:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
paritltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltft
sqdgnnhqfttkvigkdsrdfdispkvngendvvlatgsqdffvrsigskggklaagkyt
davtvtvsnq

Timeline for d1p5uc_:

• d1p5uc_ first appeared in SCOP 1.65
  
• d1p5uc_ appears in SCOP 1.75
  
• d1p5uc_ appears in SCOPe 2.02
  
• d1p5uc_ appears in the current release, SCOPe 2.08