| Class b: All beta proteins [48724] (177 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
| Family b.2.3.2: Pilus subunits [49405] (10 proteins) |
| Protein F1 capsule antigen Caf1 [89213] (1 species) |
| Species Yersinia pestis [TaxId:632] [89214] (6 PDB entries) |
| Domain d1p5ub_: 1p5u B: [87810] Other proteins in same PDB: d1p5ua1, d1p5ua2 |
PDB Entry: 1p5u (more details), 1.99 Å
SCOPe Domain Sequences for d1p5ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p5ub_ b.2.3.2 (B:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
adltasttrtatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
ffvrsigskggklaagkytdavtvtvsnq
Timeline for d1p5ub_: