SCOPe 2.02: Domain d1p5ub_: 1p5u B:

Lineage for d1p5ub_ (1p5u B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (9 proteins)

6. Protein F1 capsule antigen Caf1 [89213] (1 species)

7. Species Yersinia pestis [TaxId:632] [89214] (6 PDB entries)

8. Domain d1p5ub_: 1p5u B: [87810]
   Other proteins in same PDB: d1p5ua1, d1p5ua2

Details for d1p5ub_

PDB Entry: 1p5u, 1.99 Å

PDB Description: x-ray structure of the ternary caf1m:caf1:caf1 chaperone:subunit:subunit complex

PDB Compounds: (B:) F1 capsule antigen

SCOPe Domain Sequences for d1p5ub_:

Sequence; same for both SEQRES and ATOM records:

>d1p5ub_ b.2.3.2 (B:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
adltasttrtatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
ffvrsigskggklaagkytdavtvtvsnq

Timeline for d1p5ub_:

• d1p5ub_ first appeared in SCOP 1.65
  
• d1p5ub_ appears in SCOPe 2.01
  
• d1p5ub_ appears in SCOPe 2.03
  
• d1p5ub_ appears in the current release, SCOPe 2.08