Lineage for d1p5ua2 (1p5u A:148-234)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773151Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 2773152Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 2773153Protein Caf1m [89221] (1 species)
    chaperone of F1 capsule antigen Caf1
  7. 2773154Species Yersinia pestis [TaxId:632] [89222] (8 PDB entries)
  8. 2773155Domain d1p5ua2: 1p5u A:148-234 [87809]
    Other proteins in same PDB: d1p5ua1, d1p5ub_, d1p5uc_

Details for d1p5ua2

PDB Entry: 1p5u (more details), 1.99 Å

PDB Description: x-ray structure of the ternary caf1m:caf1:caf1 chaperone:subunit:subunit complex
PDB Compounds: (A:) Chaperone protein Caf1M

SCOPe Domain Sequences for d1p5ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p5ua2 b.7.2.1 (A:148-234) Caf1m {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg
lagarnvswriindqggldrlysknvt

SCOPe Domain Coordinates for d1p5ua2:

Click to download the PDB-style file with coordinates for d1p5ua2.
(The format of our PDB-style files is described here.)

Timeline for d1p5ua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p5ua1