SCOP 1.69: Domain d1p5ec_: 1p5e C:

Lineage for d1p5ec_ (1p5e C:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (53 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (79 PDB entries)

8. Domain d1p5ec_: 1p5e C: [87799]
   Other proteins in same PDB: d1p5eb1, d1p5eb2, d1p5ed1, d1p5ed2

Details for d1p5ec_

PDB Entry: 1p5e, 2.22 Å

PDB Description: the structure of phospho-cdk2/cyclin a in complex with the inhibitor 4,5,6,7-tetrabromobenzotriazole (tbs)

SCOP Domain Sequences for d1p5ec_:

Sequence; same for both SEQRES and ATOM records:

>d1p5ec_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens)}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

Timeline for d1p5ec_:

• d1p5ec_ first appeared in SCOP 1.65
  
• d1p5ec_ appears in SCOP 1.67
  
• d1p5ec_ appears in SCOP 1.71
  
• d1p5ec_ appears in the current release, SCOPe 2.07, called d1p5ec1