Lineage for d1p52a2 (1p52 A:96-357)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872298Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 872299Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families) (S)
  5. 872430Family d.128.1.2: Guanido kinase catalytic domain [55935] (2 proteins)
  6. 872431Protein Arginine kinase, C-terminal domain [55942] (1 species)
  7. 872432Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [55943] (7 PDB entries)
    Uniprot P51541
  8. 872436Domain d1p52a2: 1p52 A:96-357 [87793]
    Other proteins in same PDB: d1p52a1
    complexed with adp, dar, mg, no3; mutant

Details for d1p52a2

PDB Entry: 1p52 (more details), 1.9 Å

PDB Description: structure of arginine kinase e314d mutant
PDB Compounds: (A:) arginine kinase

SCOP Domain Sequences for d1p52a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p52a2 d.128.1.2 (A:96-357) Arginine kinase, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
tdkhppkqwgdintlvdldpagqfiistrvrcgrslqgypfnpcltaeqykemeekvsst
lssmedelkgtyypltgmskatqqqliddhflfkegdrflqtanacrywptgrgifhnda
ktflvwvneedhlriismqkggdlktvykrlvtavdniesklpfshddrfgfltfcptnl
gttmrasvhiqlpklakdrkvlediaskfnlqvrgtrgdhteseggvydisnkrrlglte
yqavremqdgilemikmekaaa

SCOP Domain Coordinates for d1p52a2:

Click to download the PDB-style file with coordinates for d1p52a2.
(The format of our PDB-style files is described here.)

Timeline for d1p52a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p52a1